PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01743.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 248aa    MW: 28860.5 Da    PI: 9.1817
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01743.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.8e-181057148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT++Ed +lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Rsa1.0_01743.1_g00007.1 10 KGPWTEQEDIILVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 57
                             79********************************************97 PP

2Myb_DNA-binding56.27.7e-1863108148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
  Rsa1.0_01743.1_g00007.1  63 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 108
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.094557IPR017930Myb domain
SuperFamilySSF466895.75E-309104IPR009057Homeodomain-like
SMARTSM007177.6E-16959IPR001005SANT/Myb domain
PfamPF002491.7E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-211164IPR009057Homeodomain-like
CDDcd001672.96E-111257No hitNo description
PROSITE profilePS5129427.41458112IPR017930Myb domain
SMARTSM007172.2E-1762110IPR001005SANT/Myb domain
PfamPF002492.7E-1663107IPR001005SANT/Myb domain
CDDcd001673.62E-1265108No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2465111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MNMMQEENRK GPWTEQEDII LVNFVHLFGD RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGKMTPQE ERLVLELHAK WGNRWSKIAR KLPGRTDNEI KNYWRTHMRK KTQEKKRHVS  120
PSSSCSNCCS SSMTTTNTQD VSFQSSGKVS FYDTGGNREM NQETKDGYSM DDIWKEIDHS  180
AVKVTQPVKD IYLEQSYCLS YPTLASPSWE SSLDSVWKMD ADKSKMSSFA DDQFPFCFQH  240
SRSPWSSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-28101124105MYB PROTO-ONCOGENE PROTEIN
1msf_C3e-28101124105C-Myb DNA-Binding Domain
1mse_C3e-28101124105C-Myb DNA-Binding Domain
1h89_C1e-271011258159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-271011258159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667380.0KC966738.1 Brassica napus MYB transcription factor 48 (MYB48.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625304.11e-167PREDICTED: transcription factor MYB48
SwissprotQ9LX821e-146MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A078D9Z01e-167A0A078D9Z0_BRANA; BnaC03g55550D protein
TrEMBLA0A0D3BHG51e-167A0A0D3BHG5_BRAOL; Uncharacterized protein
STRINGBra018223.1-P1e-165(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.11e-145myb domain protein 48